PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0006s0093.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 494aa    MW: 54194.1 Da    PI: 7.1942
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0006s0093.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.26.5e-32272327156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Kalax.0006s0093.1.p 272 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 327
                          68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508739.30917325IPR002016Haem peroxidase, plant/fungal/bacterial
PROSITE profilePS5129412.22269329IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-28270330IPR009057Homeodomain-like
SuperFamilySSF466893.91E-17270330IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-26272327IPR006447Myb domain, plants
PfamPF002498.8E-7274325IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006979Biological Processresponse to oxidative stress
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0055114Biological Processoxidation-reduction process
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0004601Molecular Functionperoxidase activity
GO:0020037Molecular Functionheme binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
MTPPSELSLD FKPHSYSMLL KSFASGEHQQ PDLKQLEDFL ACLEDERLKI EAFKRELPLC  60
MQLLSNAVEA SRQKLQAVKS SNQGPRPVLE EFIPLKSPTA GGEEDHAASK NASDKSNWMV  120
SAQLWSQTPS TDNNGPITRQ LESPYQTDMG LNITSSNLTL LDTSHTTKQR NSGAFSPFNK  180
DRTSTGPNLP NPNLALANTN DHHLLEEKKI GSELIPDCPT RETIITPGNF NGAGMMDDEP  240
MKGTNNSADT LTTSNTTHTT NNNSSSNQPH RKARRCWSPD LHRRFVNALQ MLGGSQVATP  300
KQIRELMKVD GLTNDEVKSH LQKYRLHTRR PSPSPQPAAG GPAAQLVVLG GIWVPPEYAA  360
HHSGATAALY GAAPHQAVGP EFYAAAGPHH RQLFHIHQQQ QMQMHQIHLQ QQHHHHQAVQ  420
VYNNKASSRT HSSPESDARG AVGDRSESIE DGKSESGSWK GGESVENGRE RMKVGARRDG  480
GEESNGSEIT LKF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012078695.11e-150PREDICTED: uncharacterized protein LOC105639296 isoform X1
TrEMBLA0A067KBG01e-150A0A067KBG0_JATCU; Uncharacterized protein
STRINGPOPTR_0006s16000.11e-146(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.15e-83G2-like family protein